DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and dbx1a

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_571233.1 Gene:dbx1a / 30394 ZFINID:ZDB-GENE-000128-8 Length:314 Species:Danio rerio


Alignment Length:80 Identity:37/80 - (46%)
Similarity:48/80 - (60%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 LSLSKKQRKA---RTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKW 435
            |:...|.|:.   |..|:|.|.:.|||.|::|||:|..||.:||.||.|.|.|||.|:||||.||
Zfish   166 LAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQVKIWFQNRRMKW 230

  Fly   436 KRQTAVGLELLAEAG 450
            :....  .|||:..|
Zfish   231 RNSKE--RELLSSGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 31/58 (53%)
dbx1aNP_571233.1 Homeodomain 178..232 CDD:459649 30/53 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..279 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.