DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and VENTX

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_055283.1 Gene:VENTX / 27287 HGNCID:13639 Length:258 Species:Homo sapiens


Alignment Length:261 Identity:72/261 - (27%)
Similarity:101/261 - (38%) Gaps:76/261 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LGGPGSSISGDQASTIDDSDSDDCGGKDDDGDDSMKNGS-SANGDSSSHLSLSLSKKQR-----K 382
            |.|||.:                .|.::.....|:|..: |:|..:.......|||:..     :
Human    45 LPGPGQT----------------SGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPR 93

  Fly   383 ARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAVGLELLA 447
            .|||||..|::|||..|:..:|||..:|..||.:::||:.|:|||:||||.|.|||.        
Human    94 VRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQM-------- 150

  Fly   448 EAGNYAAFQRLYGGATPYLSAWPYAAAAAAQSPHGATPSAIDIYYRQAAAAAAMQKPSLPASYRM 512
                          ..|.|.: |::.:..|.....:|.|.:       |....:..|..|.|.  
Human   151 --------------QDPQLHS-PFSGSLHAPPAFYSTSSGL-------ANGLQLLCPWAPLSG-- 191

  Fly   513 YQSSIPPGMSLPGMPAPPPPGAAPMLSGYYAAAAAAAASAGA----QQQQQQPPAASR---SPAT 570
                 |..:.|       |||:   ..|....|..|.|||||    |.....||...|   .||.
Human   192 -----PQALML-------PPGS---FWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPAL 241

  Fly   571 S 571
            |
Human   242 S 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 27/51 (53%)
VENTXNP_055283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 12/63 (19%)
Homeobox 95..147 CDD:306543 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.