DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and Obox6

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_663756.2 Gene:Obox6 / 252830 MGIID:2149036 Length:347 Species:Mus musculus


Alignment Length:241 Identity:53/241 - (21%)
Similarity:94/241 - (39%) Gaps:46/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 SSANGDSSSHLSLSLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKT 426
            |.:.||  ..:||...:|.||.||.:|:.|...|:|.|.:..|.|.:.||.||..:.::..:::.
Mouse   129 SPSYGD--RRVSLVTPRKHRKIRTVYTEEQKCVLKKHFHKCTYPSREQRMALAVLVGVTANEIQI 191

  Fly   427 WYQNRRTKWKRQTAVGLELLAEAGNYAAFQRLYGGATPYLSAWPYAAAAAAQSPHGATPSAIDIY 491
            |::|.|.|.||::...:.        ||.....|           ::.|.::|.|  .|.::.:.
Mouse   192 WFKNHRAKSKRESLQNVP--------AALPETNG-----------SSEAVSESVH--FPDSLPVV 235

  Fly   492 YRQAAA------AAAMQKPSLPASYRMYQSSIPPGMSLPGMPAPPPP-----GAAPMLSGYYAAA 545
               |:|      :....:.|:| :....|.|.||...........|.     |.||:.:.....:
Mouse   236 ---ASANGESMWSGTFGEDSIP-NLNWSQESSPPHYQACDSARYCPQEYLLNGHAPVTAWNSGQS 296

  Fly   546 AAAAASAGAQQQQQQPPAASRSPATSQSANSEADCERTSSSSRQRL 591
            .|.....|.        |.:.:|....::....:..:.|..|.:.|
Mouse   297 VAVEVQTGL--------AVAEAPVVMVASTQGPEYAQDSGPSTEEL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 17/51 (33%)
Obox6NP_663756.2 COG5576 86..>204 CDD:227863 27/76 (36%)
homeodomain 146..204 CDD:238039 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.