DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and Tlx2

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_033418.1 Gene:Tlx2 / 21909 MGIID:1350935 Length:284 Species:Mus musculus


Alignment Length:255 Identity:70/255 - (27%)
Similarity:102/255 - (40%) Gaps:84/255 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 DPAQHLSHLSHLSHQQHHPHLHHPMH---DERSRSPLMLQQLGGNGGNNNNNNNNSSSASNNNNN 292
            :||...:|        |.|| |.|:.   |:....|   :..||..|...:..::..||:.::..
Mouse     2 EPAVLAAH--------HLPH-HEPISFGIDQILSGP---EPPGGGLGPGQSGQSHGESAAFSSGF 54

  Fly   293 NNNSASANSNIISGNSSSSNNNNGSGNGNML-------------------------LGGPGSSIS 332
            :..|..|.    :|:.:|....:|.|.|.::                         |||.|    
Mouse    55 HGASGYAP----AGSLASLPRGSGVGPGGVIRVPAHRPLPVPPPSGAAPAVPGPSGLGGAG---- 111

  Fly   333 GDQASTIDDSDSDDCGGKDDDGDDSMKNGSSANGDSSSHLSLSLS-----------------KKQ 380
            |....|....||.....||                   .|:.:||                 .|:
Mouse   112 GLAGLTFPWMDSGRRFAKD-------------------RLTAALSPFSGTRRIGHPYQNRTPPKR 157

  Fly   381 RKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTA 440
            :|.||:|:..|:..||:.|.|||||:..:|..||..|.::|.|||||:|||||||:||||
Mouse   158 KKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 28/51 (55%)
Tlx2NP_033418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..52 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..104 1/25 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..166 5/25 (20%)
Homeobox 160..213 CDD:306543 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.