DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and Nkx1-2

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:269 Identity:79/269 - (29%)
Similarity:116/269 - (43%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 SGNSSSSNNNNGSGNGNMLLG---GPGSSISGDQASTIDDSDSDDCG------------------ 348
            :|..:.|.|..||......:|   .|||.:.|.:|.  ::.:::|.|                  
Mouse    55 AGQDACSGNPIGSQETPDAVGRGIDPGSPVEGSEAE--EEEEAEDAGRAHQPERWQGVHEGSPEA 117

  Fly   349 -----GKDDDGDDSM--KNGSSANGDSSSHLSLSLSKKQRKARTAFTDHQLQTLEKSFERQKYLS 406
                 |.::.|.:.:  ..||..:.......:.|...|.|:||||||..||..||..|...:|||
Mouse   118 RAVAVGTEESGAEGLPASPGSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLS 182

  Fly   407 VQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNYAAFQRLYGGATPYLSAWPY 471
            |.:|:.||..|.|::.|||.|:||||||||:|.. |.:...:||         |||..  ...|.
Mouse   183 VCERLNLALSLSLTETQVKIWFQNRRTKWKKQNP-GADGAVQAG---------GGAPQ--PGTPG 235

  Fly   472 AAAAAAQSPHGATPSAIDIYYRQAAAAAAMQK-PSLPASYRMY-QSSIPPGMSLPGMPAPPPPGA 534
            |.|....|..|::|..      ....|...|. |:.||:..:: .:|.|...:..|.|..|..|.
Mouse   236 AVAGGGGSATGSSPGP------PVPGALPYQTFPTYPATNVLFPAASFPLTTAANGSPFTPFLGP 294

  Fly   535 APMLSGYYA 543
            : .|:.:||
Mouse   295 S-YLTPFYA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 29/51 (57%)
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 19/104 (18%)
Homeobox 160..212 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.