DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and ceh-31

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_508525.3 Gene:ceh-31 / 191621 WormBaseID:WBGene00000452 Length:260 Species:Caenorhabditis elegans


Alignment Length:216 Identity:85/216 - (39%)
Similarity:112/216 - (51%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 NNNNSSSASNNNNNNNNSASANSNIISGNSSSSNN--------NNGSGNGNMLLGGPGSSISGDQ 335
            |...:.|:|.....|.||:...|:::...|.|:|.        |:.....:..:|.|.:..|.::
 Worm    20 NQLAAQSSSGGAKINLNSSFRISDLLDPTSHSTNEPDPSPTSINSSESPSSPRIGSPNTERSVNE 84

  Fly   336 ASTIDDSDSDDCGGKDDDGDDSMKNGSSANGDSSSHLSLSLSKKQRKARTAFTDHQLQTLEKSFE 400
            :.|        |.|                           |||.|||||.|||.|||.||.:||
 Worm    85 SPT--------CVG---------------------------SKKARKARTIFTDKQLQELENTFE 114

  Fly   401 RQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNYAAFQRLYGGATPY 465
            :|||||||||||||:::.|:|.||||||||||||||||.:||::||.:|||.||.|:|       
 Worm   115 KQKYLSVQDRMELAHRMGLTDTQVKTWYQNRRTKWKRQASVGMDLLHDAGNMAAVQQL------- 172

  Fly   466 LSAWPYAAAAAAQ--SPHGAT 484
            |...||.|...:|  |..||:
 Worm   173 LRTNPYWANYLSQNTSMFGAS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 39/51 (76%)
ceh-31NP_508525.3 Homeobox 98..150 CDD:278475 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167947
Domainoid 1 1.000 97 1.000 Domainoid score I4537
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002353
OrthoInspector 1 1.000 - - mtm4821
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10747
SonicParanoid 1 1.000 - - X1387
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.920

Return to query results.
Submit another query.