DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and ceh-19

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001023142.1 Gene:ceh-19 / 177590 WormBaseID:WBGene00000442 Length:199 Species:Caenorhabditis elegans


Alignment Length:170 Identity:51/170 - (30%)
Similarity:74/170 - (43%) Gaps:55/170 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 DDSDSDDCGGKDD--------DGDDSMKNGSSAN-------------------GDSSSHLSLSLS 377
            :::||:..|.:|:        ||..:|.....|.                   |.|:.......|
 Worm    24 EENDSEKNGEEDEEEEEKNVIDGWTNMATSQLAMFAIANDLRTPTLVELQMLLGVSARKHDYKRS 88

  Fly   378 KK---QRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQ- 438
            :|   :||.|.|::..||..||..|:..|||||..|::|:..|.|::.|:|||:||||||||:| 
 Worm    89 RKSVCERKPRQAYSARQLDRLETEFQTDKYLSVNKRIQLSQTLNLTETQIKTWFQNRRTKWKKQL 153

  Fly   439 --------------TAVGLELLAEAGNYAAFQRLYGGATP 464
                          |:||:          .||.|....||
 Worm   154 TSSIRQMVKDAPTSTSVGV----------PFQSLLTPPTP 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 26/51 (51%)
ceh-19NP_001023142.1 Homeobox 97..150 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.