DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and Hoxb4

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus


Alignment Length:106 Identity:34/106 - (32%)
Similarity:53/106 - (50%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 RKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAVGLEL 445
            :::|||:|..|:..|||.|...:||:.:.|:|:|:.|.||:.|:|.|:||||.|||:...:....
Mouse   162 KRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTK 226

  Fly   446 LAEAGNYAAFQRLYGGATPYLSAWPYAAAAAAQSPHGATPS 486
            :...|...|     .|..|             ..|:|..|:
Mouse   227 IRSGGTAGA-----AGGPP-------------GRPNGGPPA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 26/55 (47%)
Hoxb4NP_034589.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
Antp-type hexapeptide 140..145
Homeodomain 162..218 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..250 7/49 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.