DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and Dlx4

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:159 Identity:48/159 - (30%)
Similarity:78/159 - (49%) Gaps:37/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 SLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQT 439
            ||::|.||.||.::..|||.|.:.|:..:||::.:|.:||.:|.|:..|||.|:||:|:|:|:  
Mouse   111 SLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKK-- 173

  Fly   440 AVGLELLAEAGNYAAFQRLYGGATPYLSAWPYAAAAAAQSPHGATPSAIDIYYRQAAAAAAMQKP 504
                 ||.::....  :..:.|..|.|            |||  :|:...|:       ...:..
Mouse   174 -----LLKQSSGEP--EEDFSGRPPSL------------SPH--SPALPFIW-------GLPKAD 210

  Fly   505 SLPAS-Y------RMYQSSIPPGMSLPGM 526
            :||:| |      ..||...|..::||.|
Mouse   211 TLPSSGYDNSHFGAWYQHRSPDVLALPQM 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 24/55 (44%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70
Homeodomain 117..173 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194 4/32 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.