DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and Barx2

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_038828.2 Gene:Barx2 / 12023 MGIID:109617 Length:283 Species:Mus musculus


Alignment Length:79 Identity:40/79 - (50%)
Similarity:52/79 - (65%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 ANGDSSSHLSLSLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWY 428
            |:.:|.:.......||.|::||.||:.||..|||.|::|||||..||::||..|.|:..||||||
Mouse   121 ASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWY 185

  Fly   429 QNRRTKWKRQTAVG 442
            ||||.|||:....|
Mouse   186 QNRRMKWKKMVLKG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 32/51 (63%)
Barx2NP_038828.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..141 5/19 (26%)
Homeobox 140..193 CDD:306543 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..283 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.