DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and Barx1

DIOPT Version :10

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_031552.2 Gene:Barx1 / 12022 MGIID:103124 Length:254 Species:Mus musculus


Alignment Length:109 Identity:49/109 - (44%)
Similarity:60/109 - (55%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 CGGKDDDGDDSMKNGSSANGDS-SSHLSLSL-----------------SKKQRKARTAFTDHQLQ 393
            |.|.   |...:..|....|.: :|||.|.|                 :||.|::||.||:.||.
Mouse    94 CSGL---GSALLAAGPGMPGPAGASHLPLELQLRGKLEAAGSGEPGAKAKKGRRSRTVFTELQLM 155

  Fly   394 TLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKR 437
            .|||.||:|||||..||::||..|.||..||||||||||.|||:
Mouse   156 GLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeodomain 381..437 CDD:459649 36/55 (65%)
Barx1NP_031552.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Homeodomain 143..199 CDD:459649 36/55 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.