DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and dbx1

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_002940015.1 Gene:dbx1 / 100495433 XenbaseID:XB-GENE-480177 Length:328 Species:Xenopus tropicalis


Alignment Length:252 Identity:63/252 - (25%)
Similarity:87/252 - (34%) Gaps:95/252 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 LSLSKKQRKA---RTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKW 435
            |:...|.|:.   |..|:|.|.:.|||.|::|||:|..||.:||.||.|.|.|||.|:||||.||
 Frog   163 LAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAGKLGLKDSQVKIWFQNRRMKW 227

  Fly   436 KRQTAVGLELLAEAGNYAAFQRLYGGATPYLSAWPYAAAAAAQSPHGATPSAIDIYYRQAAAAAA 500
            :....  .|||:..|                                                  
 Frog   228 RNSKE--RELLSSGG-------------------------------------------------- 240

  Fly   501 MQKPSLPASYRMYQSSIPPGMSLPGMPAPPPPGAAPMLSGYYAAAAAAAASAGAQQQQQQPPAAS 565
            .::.:||..:.               |.|.........||               :.:::|  ..
 Frog   241 CREQTLPTKFN---------------PHPDLSDVGKKSSG---------------EGEEEP--MC 273

  Fly   566 RSPATSQSANSEADCERTSSSSRQRLITPSPPLNP--GSPPHRERINEEEDRERDEE 620
            .|||.|    |...|...|.....:|  |..|.|.  .|.|.....:|||:.|::||
 Frog   274 NSPAHS----SPYQCPEHSLRLDAQL--PPSPFNSSIASKPSDFSDSEEEEGEQEEE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 29/51 (57%)
dbx1XP_002940015.1 Homeobox 175..229 CDD:365835 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.