DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B-H2 and barx1

DIOPT Version :9

Sequence 1:NP_523386.1 Gene:B-H2 / 32723 FlyBaseID:FBgn0004854 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_004914882.1 Gene:barx1 / 100491751 XenbaseID:XB-GENE-919916 Length:253 Species:Xenopus tropicalis


Alignment Length:245 Identity:73/245 - (29%)
Similarity:97/245 - (39%) Gaps:88/245 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 EALHRHGHGLTGDPAQHLSHL---SHLSHQQHHPHLHHPMHDERS-----RSPLMLQQLGGNGGN 275
            |.|..|.......||..|...   :.||.:.:|.||.....::.|     .|||....||     
 Frog    32 EILTDHQDPKASPPAGELLKFGVQALLSARPYHNHLALLKAEQASVFKFPLSPLSCPALG----- 91

  Fly   276 NNNNNNNSSSASNNNNNNNNSASANSNIISGNSSSSNNNNGSGNGNMLLGGPGS--------SIS 332
                                 :..:|.:::.         |||    |.||||:        .:.
 Frog    92 ---------------------SPISSALLAA---------GSG----LQGGPGTPHHLPLELHLR 122

  Fly   333 GDQASTIDDSDSDDCGGKDDDGDDSMKNGSSANGDSSSHLSLSLSKKQRKARTAFTDHQLQTLEK 397
            |...|::.:.     ||                         |.:||.|::||.||:.||..|||
 Frog   123 GKLESSVSEQ-----GG-------------------------SKAKKGRRSRTVFTELQLMGLEK 157

  Fly   398 SFERQKYLSVQDRMELANKLELSDCQVKTWYQNRRTKWKRQTAV---GLE 444
            .||:|||||..||::||..|.||..||||||||||.|||:...:   |||
 Frog   158 RFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIQVLQGGGLE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B-H2NP_523386.1 Homeobox 384..436 CDD:278475 34/51 (67%)
barx1XP_004914882.1 Homeobox 143..197 CDD:365835 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24330
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.