DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5445 and NBR1

DIOPT Version :9

Sequence 1:NP_001285371.1 Gene:CG5445 / 32722 FlyBaseID:FBgn0030838 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_194200.1 Gene:NBR1 / 828571 AraportID:AT4G24690 Length:704 Species:Arabidopsis thaliana


Alignment Length:295 Identity:59/295 - (20%)
Similarity:98/295 - (33%) Gaps:93/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LTTNTTTTTNPMMAIPLPAPPGPHS-----APNNS---PNSNANPNS------------NLSPSP 92
            ::..|.|...|   :.|..|.|.||     .||:|   .|.|..|.|            ||:..|
plant   203 ISERTQTGRKP---VNLNEPTGAHSKTSGHVPNSSGLGANFNECPFSGSTMNYSCPNPVNLNKHP 264

  Fly    93 -----SATTANASAST--------IKC-----LPTNDFDIDSLLLQQFSCMGTTDHEDLISQFQS 139
                 |..:.|....|        |:|     ||.......|.:.:.:         ||.:...|
plant   265 RRVCHSKKSTNGDYWTSLGVFHKGIRCDGCGVLPITGPRFKSKVKEDY---------DLCTICYS 320

  Fly   140 LMNNQMNRESARFYLEMSNWSLQTAVGCYLDF--------------------CSLQSLPSMKIVQ 184
            :|.|:  .:..|....:|...|....|.:..|                    |:...|.|..::.
plant   321 VMGNE--GDYTRMDKPVSVQHLHPFRGPFTQFPNPWLSHPVPRATNGGAPLRCTRPKLDSRFVLD 383

  Fly   185 EKQVNAQQQA--------FQLQNDGTERWPNNCY------------LTSPIQTQRINVPALRPGE 229
            ...::....|        ::::|.|:..||....            |:..:|..:..||.....:
plant   384 VNVIDGTVVAPSAPFTKIWKMRNSGSLVWPQGTQIVWIGGDRFCNSLSVDLQIPKEGVPIYSELD 448

  Fly   230 T-CDILADMMPTQPPTMWRLCTSNGWYFGDAIWMI 263
            . .|.:|..:|.:..:.||:.||:|..||..:|::
plant   449 VKVDFVAPELPGRYISYWRMATSDGAKFGQRVWVL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5445NP_001285371.1 UBA_CF106 129..170 CDD:270534 9/40 (23%)
NBR1_like <197..261 CDD:304553 18/76 (24%)
NBR1NP_194200.1 PB1_Joka2 8..94 CDD:99720
ZZ 289..331 CDD:412288 10/52 (19%)
NBR1_like 374..487 CDD:271343 22/110 (20%)
UBA_NBR1 618..656 CDD:270504
UBA_NBR1 660..698 CDD:270504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4351
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006607
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20930
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.