DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5445 and ILRUN

DIOPT Version :9

Sequence 1:NP_001285371.1 Gene:CG5445 / 32722 FlyBaseID:FBgn0030838 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_077270.1 Gene:ILRUN / 64771 HGNCID:21215 Length:298 Species:Homo sapiens


Alignment Length:172 Identity:65/172 - (37%)
Similarity:94/172 - (54%) Gaps:19/172 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DFDIDSLLLQQFSCMGTTDHEDLISQFQSLMNNQMNRESARFYLEMSNWSLQTAVGCYLDFCSLQ 175
            |.|:|..|:|:|||:||||.:.|||:||.|:..|:|.....|:|:|:||:||.|:|.|.||.|..
Human     5 DVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPN 69

  Fly   176 -SLPSMKIVQEKQVNAQQ---------QAFQLQNDGTERWPNNCYL--TSPIQTQRIN---VPAL 225
             |:|||..|::..:...:         :.:::||.|.|.||....|  ....|...:|   |.:|
Human    70 ISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSL 134

  Fly   226 RPGETCDILADMMPTQPPTM----WRLCTSNGWYFGDAIWMI 263
            .|.|..|:...|.......|    ||:||:.|.|:||.||:|
Human   135 EPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5445NP_001285371.1 UBA_CF106 129..170 CDD:270534 19/40 (48%)
NBR1_like <197..261 CDD:304553 24/72 (33%)
ILRUNNP_077270.1 UBA_CF106 23..64 CDD:270534 19/40 (48%)
NBR1_like 71..180 CDD:271343 32/106 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12052
eggNOG 1 0.900 - - E1_KOG4351
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4834
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359706at2759
OrthoFinder 1 1.000 - - FOG0006607
OrthoInspector 1 1.000 - - oto90324
orthoMCL 1 0.900 - - OOG6_106124
Panther 1 1.100 - - LDO PTHR20930
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4250
SonicParanoid 1 1.000 - - X6354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.