DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5445 and nbr1b

DIOPT Version :9

Sequence 1:NP_001285371.1 Gene:CG5445 / 32722 FlyBaseID:FBgn0030838 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001373572.1 Gene:nbr1b / 555713 ZFINID:ZDB-GENE-170215-1 Length:992 Species:Danio rerio


Alignment Length:184 Identity:39/184 - (21%)
Similarity:60/184 - (32%) Gaps:59/184 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NLSP---SPSATTANASASTIKCLPTNDFDIDSLLLQQFSCMGTTDHEDLISQFQSLMNNQMNRE 148
            |.||   .|.||.||:.....:..|.....:.:|||.                 ::|.:....|.
Zfish   331 NSSPVLLQPRATQANSPDRPKRPCPLAVPAMTALLLD-----------------ENLPDGSRLRP 378

  Fly   149 SARF--YLEMSNWSLQTAVGCYLDFCSLQSLPSMKIVQEKQVNAQQQAFQLQNDGTERWPNNCYL 211
            ..:|  |.:|.|                    |.::..:.:...:.....|.....|||      
Zfish   379 GTKFIKYWKMKN--------------------SGRVCWDSETKLKFMWGNLAVGSGERW------ 417

  Fly   212 TSPIQTQRINVPALRPGETCDI-LADMMPTQPPTM---WRLCTSNGWYFGDAIW 261
                  :.:.||.|:||:...: :|...||...|.   ||| ...|..||..:|
Zfish   418 ------REVPVPTLQPGQVGVVSVALCAPTIEGTYTSHWRL-AHRGEQFGPRVW 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5445NP_001285371.1 UBA_CF106 129..170 CDD:270534 6/42 (14%)
NBR1_like <197..261 CDD:304553 19/67 (28%)
nbr1bNP_001373572.1 PB1_NBR1 5..85 CDD:99718
ZZ 223..261 CDD:412288
NBR1_like 363..470 CDD:271343 30/152 (20%)
UBA_NBR1 944..980 CDD:270504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4351
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.