DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5445 and ilrun

DIOPT Version :9

Sequence 1:NP_001285371.1 Gene:CG5445 / 32722 FlyBaseID:FBgn0030838 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_009301002.1 Gene:ilrun / 541415 ZFINID:ZDB-GENE-050320-117 Length:285 Species:Danio rerio


Alignment Length:172 Identity:66/172 - (38%)
Similarity:95/172 - (55%) Gaps:19/172 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DFDIDSLLLQQFSCMGTTDHEDLISQFQSLMNNQMNRESARFYLEMSNWSLQTAVGCYLDFCSLQ 175
            |.|:|..|:|:||||||||.:.|||:||.|:..|:|.....|:|:|:||:||.|:|.|.||.|..
Zfish     7 DIDLDQELMQKFSCMGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPN 71

  Fly   176 -SLPSMKIVQEKQVNAQQ---------QAFQLQNDGTERWPNNCYL--TSPIQTQRIN---VPAL 225
             :.|||..|::..:...:         :.:::||.|||.||....|  ....|...:|   |.:|
Zfish    72 INTPSMSFVEDVTIGEGESVPPDTPFTKTWRIQNTGTESWPPGVCLKYVGGDQFGHVNMVMVRSL 136

  Fly   226 RPGETCDILADMMPTQPPTM----WRLCTSNGWYFGDAIWMI 263
            .|.|..|:...|.....|.|    ||:||:.|.::||.||:|
Zfish   137 DPQEISDVSVQMRSPAVPGMYQGQWRMCTATGLFYGDVIWVI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5445NP_001285371.1 UBA_CF106 129..170 CDD:270534 19/40 (48%)
NBR1_like <197..261 CDD:304553 25/72 (35%)
ilrunXP_009301002.1 UBA_CF106 25..66 CDD:270534 19/40 (48%)
NBR1_like 73..182 CDD:271343 32/106 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12078
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4803
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359706at2759
OrthoFinder 1 1.000 - - FOG0006607
OrthoInspector 1 1.000 - - oto39489
orthoMCL 1 0.900 - - OOG6_106124
Panther 1 1.100 - - LDO PTHR20930
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4250
SonicParanoid 1 1.000 - - X6354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.