Sequence 1: | NP_001285371.1 | Gene: | CG5445 / 32722 | FlyBaseID: | FBgn0030838 | Length: | 303 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001370550.1 | Gene: | C36E6.2 / 181774 | WormBaseID: | WBGene00016490 | Length: | 239 | Species: | Caenorhabditis elegans |
Alignment Length: | 211 | Identity: | 47/211 - (22%) |
---|---|---|---|
Similarity: | 82/211 - (38%) | Gaps: | 77/211 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 IDSLLLQQFSCMGTTDHEDLISQFQSLMNNQM-NRESARFYLEMSNWSLQTAVGCYLDFCSLQSL 177
Fly 178 PSMKIVQEKQVNAQQQAF----------------------------------QLQNDGTERWPNN 208
Fly 209 CYLT-----------------SPIQTQRINVPALRPGETCDILADMMPTQPPTMWRLCTSNGWYF 256
Fly 257 GDAIWMI---PPGTQA 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5445 | NP_001285371.1 | UBA_CF106 | 129..170 | CDD:270534 | 16/41 (39%) |
NBR1_like | <197..261 | CDD:304553 | 17/80 (21%) | ||
C36E6.2 | NP_001370550.1 | UBA_CF106 | 19..61 | CDD:270534 | 16/41 (39%) |
NBR1_like | 99..187 | CDD:271343 | 20/96 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4351 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1359706at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0006607 | |
OrthoInspector | 1 | 1.000 | - | - | oto19073 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_106124 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4250 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
9 | 8.710 |