DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5445 and C36E6.2

DIOPT Version :9

Sequence 1:NP_001285371.1 Gene:CG5445 / 32722 FlyBaseID:FBgn0030838 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001370550.1 Gene:C36E6.2 / 181774 WormBaseID:WBGene00016490 Length:239 Species:Caenorhabditis elegans


Alignment Length:211 Identity:47/211 - (22%)
Similarity:82/211 - (38%) Gaps:77/211 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IDSLLLQQFSCMGTTDHEDLISQFQSLMNNQM-NRESARFYLEMSNWSLQTAVGCYLDFCSLQSL 177
            :::.|:.:.|.|.|.|.|:||.:|:.:::.|| ..:.|.|||:::||:|.||:..:.|       
 Worm     4 LENSLISKMSQMTTDDRENLIHKFEEIISPQMIPHDLAAFYLDLANWNLSTAISVFYD------- 61

  Fly   178 PSMKIVQEKQVNAQQQAF----------------------------------QLQNDGTERWPNN 208
                  |...:...::||                                  ::.|||..|||:.
 Worm    62 ------QNGDLLHMEEAFRQTCLSSTVKECTNREAISGSFTYRPNSTFFCGWRVVNDGRFRWPDG 120

  Fly   209 CYLT-----------------SPIQTQRINVPALRPGETCDILADMMPTQPPTMWRLCTSNGWYF 256
            ..|.                 .|.|::.|.:....|.|..|..|         .::..|...::|
 Worm   121 TRLAFVDGDPIDYEVWKDTVLDPDQSENIEIRISCPAEMGDFKA---------RFQFVTPQNFFF 176

  Fly   257 GDAIWMI---PPGTQA 269
            |::||:|   .|.|:|
 Worm   177 GESIWVIIRVRPLTEA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5445NP_001285371.1 UBA_CF106 129..170 CDD:270534 16/41 (39%)
NBR1_like <197..261 CDD:304553 17/80 (21%)
C36E6.2NP_001370550.1 UBA_CF106 19..61 CDD:270534 16/41 (39%)
NBR1_like 99..187 CDD:271343 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4351
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359706at2759
OrthoFinder 1 1.000 - - FOG0006607
OrthoInspector 1 1.000 - - oto19073
orthoMCL 1 0.900 - - OOG6_106124
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4250
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.