DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5445 and Nbr1

DIOPT Version :9

Sequence 1:NP_001285371.1 Gene:CG5445 / 32722 FlyBaseID:FBgn0030838 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_006532493.1 Gene:Nbr1 / 17966 MGIID:108498 Length:994 Species:Mus musculus


Alignment Length:96 Identity:20/96 - (20%)
Similarity:38/96 - (39%) Gaps:22/96 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PSMKIVQEKQVNAQQQAFQLQNDGTERWPNNCYL--------TSPIQTQRINVPALRPGETCDIL 234
            |..|.::.         ::::|.|..:|..:..|        .:..:.:.:.||.|:.|....:.
Mouse   389 PGTKFIKH---------WRMKNTGNVKWNTDTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVS 444

  Fly   235 ADMM-PTQPPTM---WRLCTSNGWYFGDAIW 261
            .:.: ||...|.   ||| :..|..||..:|
Mouse   445 VEFIAPTLEGTYTSHWRL-SHKGQQFGPRVW 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5445NP_001285371.1 UBA_CF106 129..170 CDD:270534
NBR1_like <197..261 CDD:304553 17/75 (23%)
Nbr1XP_006532493.1 PB1_NBR1 5..86 CDD:99718
ZZ_NBR1_like 216..260 CDD:239080
NBR1_like 370..480 CDD:271343 20/96 (21%)
UBA_NBR1 944..982 CDD:270504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4351
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.