DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5445 and ilrun

DIOPT Version :9

Sequence 1:NP_001285371.1 Gene:CG5445 / 32722 FlyBaseID:FBgn0030838 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001119546.1 Gene:ilrun / 100101690 XenbaseID:XB-GENE-876787 Length:278 Species:Xenopus tropicalis


Alignment Length:181 Identity:63/181 - (34%)
Similarity:94/181 - (51%) Gaps:37/181 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DFDIDSLLLQQFSCMGTTDHEDLISQFQSLMNNQMNRESARFYLEMSNWSLQTAVGCYLDFCSLQ 175
            |.|:|..|:|:|||:||||.:.|||:||.|:..|:|.....|:|:|:||:||.|:|.|.||.|..
 Frog     5 DVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPS 69

  Fly   176 -SLPSMKIVQEKQVNAQQ---------QAFQLQNDGTERWPN---------------NCYLTSPI 215
             ::|.|..|::..:...:         :.:::||.|:|.||.               |..|...:
 Frog    70 VTVPCMSFVEDVTIGEGESVPPDTQFTKTWRIQNTGSEAWPPGVCLRYVGGDQFGHVNMVLVRSL 134

  Fly   216 QTQR---INVPALRPGETCDILADMMPTQPPTMWRLCTSNGWYFGDAIWMI 263
            ..|.   ::||...|.:     |.|...|    ||:||:.|.||||.||:|
 Frog   135 DAQEMTDVSVPMCSPSQ-----AGMYQGQ----WRMCTATGLYFGDVIWVI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5445NP_001285371.1 UBA_CF106 129..170 CDD:270534 19/40 (48%)
NBR1_like <197..261 CDD:304553 24/81 (30%)
ilrunNP_001119546.1 UBA_CF106 23..64 CDD:270534 19/40 (48%)
NBR1_like 71..180 CDD:271343 30/115 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11900
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4758
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359706at2759
OrthoFinder 1 1.000 - - FOG0006607
OrthoInspector 1 1.000 - - oto104129
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6354
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.