DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fim and Y73B3B.1

DIOPT Version :9

Sequence 1:NP_728074.1 Gene:Fim / 32721 FlyBaseID:FBgn0024238 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_508051.1 Gene:Y73B3B.1 / 190640 WormBaseID:WBGene00022223 Length:376 Species:Caenorhabditis elegans


Alignment Length:363 Identity:123/363 - (33%)
Similarity:197/363 - (54%) Gaps:68/363 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 LRESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNGVYKLNLAFVANLFNNHPGLDKPEQIEGLESI 389
            |.|..::.|..:|...||::: ..|.|....:..| :|:.......|.::.|..|   ::|.::|
 Worm     4 LEEYSIEERVRVMFGSAAEVS-NDFRTQIRTIGDV-ELDEKHRICKFTSYDGKLK---LQGDQNI 63

  Fly   390 EETREEKTYRNWMNSMGVAPHVNWL-------------------YSDL-----ADGLVIFQLFDV 430
             ..|.:|.:...:....:...:|:|                   :|:|     .||:...:.::.
 Worm    64 -SARSKKQWPIRVTLAELTGFMNYLVEKTKDTIEPVVAAKLFREFSELEGEGRTDGVYYKRFYNQ 127

  Fly   431 IKPG---IVNWS-----RVHKRFSP--LRKFMEKLENC-NYAVDLGKQL--------KFSLVG-- 474
            :.|.   :|::|     ||...|:.  ...|:.::... :..:|.||::        |.:|.|  
 Worm   128 LAPNMAKLVDYSIEERLRVMFGFAAEVFDDFLAQIRTLGDVELDEGKRISKFTSTDGKLNLEGDH 192

  Fly   475 ----------------IAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPI-IEKEIVQW 522
                            ..|:.:.|||..|||||:||||||||||:|::...:|:.: .:|:||.|
 Worm   193 SHAARMKRRCAEYRNAYRGRHIYDGNQILTLALVWQLMRAYTLSVLAQYTQSGDSLPTDKDIVAW 257

  Fly   523 VNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMA 587
            ||.:|..:||.:.:|:|.||||:|||:|:||||:||...|::.||::..:.||.::||||||:..
 Worm   258 VNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDSIKPNVIDHSLVKSGKSNEDKMSNAKYAITCG 322

  Fly   588 RKIGARVYALPEDITEVKPKMVMTVFACMMALDYVPNM 625
            |||||::|||||||.|||||||:|||||:||.||:|:|
 Worm   323 RKIGAKIYALPEDIVEVKPKMVLTVFACLMARDYLPDM 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FimNP_728074.1 EF-hand_7 27..84 CDD:290234
EFh 27..80 CDD:298682
CH 127..237 CDD:278723
CH 271..370 CDD:278723 10/44 (23%)
CH 396..497 CDD:214479 32/161 (20%)
CH 517..619 CDD:214479 61/101 (60%)
Y73B3B.1NP_508051.1 SPK <1..59 CDD:214732 13/59 (22%)
SPK 79..190 CDD:214732 18/110 (16%)
CH 249..354 CDD:366016 61/104 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162659
Domainoid 1 1.000 140 1.000 Domainoid score I2952
eggNOG 1 0.900 - - E2759_KOG0046
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138895at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X500
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.