DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fim and LOC100537803

DIOPT Version :9

Sequence 1:NP_728074.1 Gene:Fim / 32721 FlyBaseID:FBgn0024238 Length:641 Species:Drosophila melanogaster
Sequence 2:XP_021326721.1 Gene:LOC100537803 / 100537803 -ID:- Length:175 Species:Danio rerio


Alignment Length:170 Identity:112/170 - (65%)
Similarity:134/170 - (78%) Gaps:4/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 FMEKLENCNYAVDLG-KQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPI 514
            |..:||||||||:|| |:.|||||||||||||:||.||||||:|||||.|||:||..|.: |..|
Zfish     2 FAPQLENCNYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDLGD-GQKI 65

  Fly   515 IEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSG-TQEDNLA 578
            |::.||||||..|::||| ..:..|.|.:|:....|:||||||:.|||.|:|::... |.|:.|.
Zfish    66 IDETIVQWVNETLTQAGK-GTISGFKDGSISSSMPVLDLIDAIQPGSIRYDLLKAEDLTDEEKLN 129

  Fly   579 NAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMMA 618
            ||||||||||||||||||||||:.|||||||||||||:||
Zfish   130 NAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLMA 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FimNP_728074.1 EF-hand_7 27..84 CDD:290234
EFh 27..80 CDD:298682
CH 127..237 CDD:278723
CH 271..370 CDD:278723
CH 396..497 CDD:214479 36/46 (78%)
CH 517..619 CDD:214479 65/103 (63%)
LOC100537803XP_021326721.1 SAC6 <6..169 CDD:227401 109/164 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138895at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.