DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8661 and CG5107

DIOPT Version :9

Sequence 1:NP_573212.1 Gene:CG8661 / 32720 FlyBaseID:FBgn0030837 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_651401.1 Gene:CG5107 / 43084 FlyBaseID:FBgn0039342 Length:213 Species:Drosophila melanogaster


Alignment Length:166 Identity:55/166 - (33%)
Similarity:89/166 - (53%) Gaps:8/166 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ELDDVTDGSLEVEDFGVLSTTYKSLKIALRSIKGLNCIIKWVAGIKDSATQFNTDVVVCGVTASK 95
            |||:.|| .::||..|.:.|..|.|:.||::::|.|||||.|..|..|.|.:...:..||....|
  Fly    49 ELDNDTD-YMDVEAQGFIRTCLKILRKALKTVRGTNCIIKEVTNILSSCTSYVDAIDACGTAIPK 112

  Fly    96 DVTKLINANNKILSTCNDLINLRSNTCPQTD---DEETKVSGSCFVKTLRKVWSLKKQVDNAIKL 157
            ||.|::::..:|:..|:|:::|.|..| .||   ....|.|..||.|..:....|.::::..:||
  Fly   113 DVAKIVDSVKEIIKICDDILHLHSKLC-ATDKSVGSSIKNSAKCFWKLFKASMRLTRKINKTLKL 176

  Fly   158 AKKIPQTGPNAVACVSDAVNTLTTYYTAFPQNIISC 193
            ..|:|   .:..:|..:|.|.:|..:.:|..||..|
  Fly   177 IAKLP---ADTSSCFVNATNKVTASFNSFLPNIDVC 209



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016623
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.