DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8661 and CG8664

DIOPT Version :9

Sequence 1:NP_573212.1 Gene:CG8661 / 32720 FlyBaseID:FBgn0030837 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001285370.1 Gene:CG8664 / 32719 FlyBaseID:FBgn0030836 Length:214 Species:Drosophila melanogaster


Alignment Length:208 Identity:52/208 - (25%)
Similarity:87/208 - (41%) Gaps:25/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILILALGLFCVNALVAPVPSALDSSSELDDVTDGSLE----------------VEDFGVLSTTYK 53
            :|::|...|   .|.....||:.:..:.:..||..|:                ||.||.:.:..|
  Fly     8 LLVVASASF---LLATANASAVGAFEDFEPYTDAELKDLYAAELMAMEDEFMGVEQFGFIGSCRK 69

  Fly    54 SLKIALRSIKGLNCIIKWVAGIKDSATQFNTDVVVCGVTASKDVTKLINANNKILSTCNDLINLR 118
            .|....:.|.|..||::.||.:..:.|.:..|:..|.....||:..::|...:::.|.|.:||::
  Fly    70 ILWAGYKGINGTKCIVEEVANVLLTCTNYVDDLSTCTGDIPKDIQAMLNNVKQMIITSNKIINMK 134

  Fly   119 SNTCPQTDD---EETKVSGSCFVKTLRKVWSLKKQVDNAIKLAKKIPQTGPNAVACVSDAVNTLT 180
            |..|..|..   ..||....|.:|......||.::::..||....:|.   |..:|..||...:.
  Fly   135 SELCASTSRSVVSSTKSFMRCTLKAFYATMSLVRRMNTLIKQGAALPF---NTSSCYVDATKKVV 196

  Fly   181 TYYTAFPQNIISC 193
            ....||..||.:|
  Fly   197 DGCNAFVPNINTC 209



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016623
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.