DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8675 and RGD1359158

DIOPT Version :9

Sequence 1:NP_573209.1 Gene:CG8675 / 32716 FlyBaseID:FBgn0030834 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001007738.1 Gene:RGD1359158 / 361740 RGDID:1359158 Length:155 Species:Rattus norvegicus


Alignment Length:226 Identity:77/226 - (34%)
Similarity:108/226 - (47%) Gaps:75/226 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSQRGNVSRTRAQKHKNRHVFKNDLHDKTPQQLRLNAMHVSTVCQRCKEQIEWKIKYKKYKPLT 65
            ||||:|||:|:|.|||:|...||||..||:.|..::||.....|||||||.:||::||.|||||:
  Rat     1 MSSQKGNVTRSRPQKHQNTFTFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLS 65

  Fly    66 QAKVCAHCKERSVKKAYHVVCRDCAIKANACAKCLKSATEVAI---EEPQPTPREEQQLQSEMDR 127
            :.|.|..|.:::||.:||::||.||.|...||||.|. .|:.|   :||:|:...|.:..:    
  Rat    66 KPKKCVKCLQKTVKDSYHIMCRPCACKLEVCAKCGKE-EEIVIPFNKEPEPSENTESEGSN---- 125

  Fly   128 LVKSFSERKRRAFLRYMRKGKKQEKDPSEEQLDEQELESQEKAKRVAHTRDELLDKIKQLNLAGD 192
                           :.|..|::|                                         
  Rat   126 ---------------HRRSCKRKE----------------------------------------- 134

  Fly   193 GDEDEDDSDFDSDEDDEDSEFDSEAEDDDSE 223
                      |||| |.|:|.|||.||:|::
  Rat   135 ----------DSDE-DLDAESDSEGEDEDTQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8675NP_573209.1 DUF2039 15..102 CDD:287221 44/86 (51%)
RGD1359158NP_001007738.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 13/20 (65%)
DUF2039 14..101 CDD:402014 45/86 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 20/118 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339307
Domainoid 1 1.000 109 1.000 Domainoid score I6239
eggNOG 1 0.900 - - E1_KOG3241
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11933
Inparanoid 1 1.050 133 1.000 Inparanoid score I4509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1584486at2759
OrthoFinder 1 1.000 - - FOG0007097
OrthoInspector 1 1.000 - - oto98552
orthoMCL 1 0.900 - - OOG6_104713
Panther 1 1.100 - - LDO PTHR22876
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5968
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.