DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8675 and C9orf85

DIOPT Version :9

Sequence 1:NP_573209.1 Gene:CG8675 / 32716 FlyBaseID:FBgn0030834 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001351982.1 Gene:C9orf85 / 138241 HGNCID:28784 Length:179 Species:Homo sapiens


Alignment Length:119 Identity:59/119 - (49%)
Similarity:80/119 - (67%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSQRGNVSRTRAQKHKNRHVFKNDLHDKTPQQLRLNAMHVSTVCQRCKEQIEWKIKYKKYKPLT 65
            ||||:|||:|:|.|||:|...||||..||:.|..::||.....|||||||.:||::||.|||||:
Human     1 MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLS 65

  Fly    66 QAKVCAHCKERSVKKAYHVVCRDCAIKANACAKCLKSATEVAIEEPQP-TPREE 118
            :.|.|..|.:::||.:||::||.||.:...||||.|. .::.|....| .||.|
Human    66 KPKKCVKCLQKTVKDSYHIMCRPCACELEVCAKCGKK-EDIVIPWSLPLLPRLE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8675NP_573209.1 DUF2039 15..102 CDD:287221 43/86 (50%)
C9orf85NP_001351982.1 DUF2039 14..102 CDD:313447 44/87 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145616
Domainoid 1 1.000 107 1.000 Domainoid score I6557
eggNOG 1 0.900 - - E1_KOG3241
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11933
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1584486at2759
OrthoFinder 1 1.000 - - FOG0007097
OrthoInspector 1 1.000 - - oto91473
orthoMCL 1 0.900 - - OOG6_104713
Panther 1 1.100 - - LDO PTHR22876
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5712
SonicParanoid 1 1.000 - - X5968
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.