DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8675 and LOC100362345

DIOPT Version :9

Sequence 1:NP_573209.1 Gene:CG8675 / 32716 FlyBaseID:FBgn0030834 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_038967029.1 Gene:LOC100362345 / 100362345 RGDID:2318341 Length:155 Species:Rattus norvegicus


Alignment Length:226 Identity:76/226 - (33%)
Similarity:108/226 - (47%) Gaps:75/226 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSQRGNVSRTRAQKHKNRHVFKNDLHDKTPQQLRLNAMHVSTVCQRCKEQIEWKIKYKKYKPLT 65
            ||||:|||:::|.|||:|...||||..||:.|..::||.....|||||||.:||::||.|||||:
  Rat     1 MSSQKGNVTQSRPQKHQNTFTFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLS 65

  Fly    66 QAKVCAHCKERSVKKAYHVVCRDCAIKANACAKCLKSATEVAI---EEPQPTPREEQQLQSEMDR 127
            :.|.|..|.:::||.:||::||.||.|...||||.|. .|:.|   :||:|:...|.:..:    
  Rat    66 KPKKCVKCLQKTVKDSYHIMCRPCACKLEVCAKCGKE-EEIVIPFNKEPEPSENTESEGSN---- 125

  Fly   128 LVKSFSERKRRAFLRYMRKGKKQEKDPSEEQLDEQELESQEKAKRVAHTRDELLDKIKQLNLAGD 192
                           :.|..|::|                                         
  Rat   126 ---------------HRRSCKRKE----------------------------------------- 134

  Fly   193 GDEDEDDSDFDSDEDDEDSEFDSEAEDDDSE 223
                      |||| |.|:|.|||.||:|::
  Rat   135 ----------DSDE-DLDAESDSEGEDEDTQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8675NP_573209.1 DUF2039 15..102 CDD:287221 44/86 (51%)
LOC100362345XP_038967029.1 DUF2039 14..101 CDD:402014 45/86 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11933
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.