DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8915 and HVT1

DIOPT Version :10

Sequence 1:NP_573208.1 Gene:CG8915 / 32715 FlyBaseID:FBgn0030833 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_850154.2 Gene:HVT1 / 817631 AraportID:AT2G30800 Length:1299 Species:Arabidopsis thaliana


Alignment Length:198 Identity:43/198 - (21%)
Similarity:82/198 - (41%) Gaps:40/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRR 72
            :|....::::.||.|.: ||..|.::|       ||.|:||       .|..:||:|....|.::
plant   195 EALHERVQKETAEQRAQ-EEQDKRERA-------ERVKRLR-------EEREEKEKEEAGREGKQ 244

  Fly    73 IIEERCGKP--------KNVEDANEDQLKDIVKEYYNRMYTCE-GQKWDLEYEVRKRDWEISDLN 128
            .|:|....|        ..|...||::::...::...:|.|.: |....||.:..:...|....:
plant   245 EIDEDTSIPMVNPFQPISAVIIENEEKIRKEKEKKRQKMQTKQNGVGIALESKEEEDKMETGSES 309

  Fly   129 AQ------VNDLRGKFVKPTLKKVSKYENKF-------AKLQKKAAEFNFRNQLKVVKKKEFTLE 180
            :|      .|||...:....::|:.:.|...       |:.:||..:...:...||   :..::|
plant   310 SQNSRTPRDNDLLESYKDALVQKLDEEEKSLDTERGDSAQSKKKTKKLKLKRNHKV---EPVSIE 371

  Fly   181 EED 183
            |.:
plant   372 ESN 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8915NP_573208.1 R3H 67..123 CDD:460206 12/64 (19%)
HrpA 208..>702 CDD:441249
OB_NTP_bind 799..884 CDD:400182
HVT1NP_850154.2 R3H_DEXH_helicase 22..80 CDD:100077
HrpA 187..>789 CDD:441249 43/198 (22%)
ANK repeat 417..444 CDD:293786
ANK repeat 446..481 CDD:293786
ANKYR <453..541 CDD:440430
ANK repeat 483..507 CDD:293786
OB_NTP_bind 895..983 CDD:400182
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.