| Sequence 1: | NP_573208.1 | Gene: | CG8915 / 32715 | FlyBaseID: | FBgn0030833 | Length: | 976 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_012820430.2 | Gene: | dhx30 / 779538 | XenbaseID: | XB-GENE-5777932 | Length: | 1184 | Species: | Xenopus tropicalis |
| Alignment Length: | 49 | Identity: | 16/49 - (32%) |
|---|---|---|---|
| Similarity: | 22/49 - (44%) | Gaps: | 5/49 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 ADDEAKKAKQAEIERKRAEVRKR--MEEASKAKKAKKGFMTPERKKKLR 48 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8915 | NP_573208.1 | R3H | 67..123 | CDD:460206 | |
| HrpA | 208..>702 | CDD:441249 | |||
| OB_NTP_bind | 799..884 | CDD:400182 | |||
| dhx30 | XP_012820430.2 | HrpA | 425..>975 | CDD:441249 | |
| OB_NTP_bind | 1004..1093 | CDD:400182 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||