DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8915 and Zcchc17

DIOPT Version :9

Sequence 1:NP_001285369.1 Gene:CG8915 / 32715 FlyBaseID:FBgn0030833 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_001102737.1 Gene:Zcchc17 / 500555 RGDID:1565267 Length:241 Species:Rattus norvegicus


Alignment Length:94 Identity:21/94 - (22%)
Similarity:37/94 - (39%) Gaps:18/94 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DSEEAVKRGRRQGRKKAQPMPEQAVVLVVNGRVTGGPKGTGKQKTRPGKNAKADAGDKLKSEDEK 67
            :.||..:..:.:|.:|..|....:         ....|...|:|.|..|::..|:.|. :|:..|
  Rat   160 EEEEEKEEAKAEGLEKPDPTKNSS---------RKRKKEKKKKKHRDRKSSDCDSPDS-ESDTGK 214

  Fly    68 MLRQLVDDFLQSCEPEKQLPGLTKAQRSH 96
            ..|....|   |..|:|:     |.::.|
  Rat   215 KARHTAKD---SKAPKKK-----KKKKKH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8915NP_001285369.1 R3H 64..123 CDD:100064 8/33 (24%)
DEXDc 214..395 CDD:214692
DEXDc 226..368 CDD:238005
HELICc 479..575 CDD:197757
HA2 648..733 CDD:214852
OB_NTP_bind 783..884 CDD:285018
Zcchc17NP_001102737.1 S1_pNO40 13..86 CDD:240191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.