DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8915 and Dhx8

DIOPT Version :10

Sequence 1:NP_573208.1 Gene:CG8915 / 32715 FlyBaseID:FBgn0030833 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_659080.2 Gene:Dhx8 / 217207 MGIID:1306823 Length:1244 Species:Mus musculus


Alignment Length:47 Identity:10/47 - (21%)
Similarity:21/47 - (44%) Gaps:11/47 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEDKEAKKSEKAD 193
            :|::|..:. ...||:|.     :::|     |......:.:|:.||
Mouse    18 TKHQNGLSS-NGDAADFE-----EIIK-----LSNHSGNSGQSQPAD 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8915NP_573208.1 R3H 67..123 CDD:460206
HrpA 208..>702 CDD:441249
OB_NTP_bind 799..884 CDD:400182
Dhx8NP_659080.2 GH2-like_DHX8 25..92 CDD:409668 8/40 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..289
S1_DHX8_helicase 289..367 CDD:240189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..396
HrpA 580..>1211 CDD:441249
DEAH box 709..712
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.