DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5172 and GRP5

DIOPT Version :9

Sequence 1:NP_573204.2 Gene:CG5172 / 32711 FlyBaseID:FBgn0030830 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_188682.1 Gene:GRP5 / 3768804 AraportID:AT3G20470 Length:174 Species:Arabidopsis thaliana


Alignment Length:151 Identity:81/151 - (53%)
Similarity:85/151 - (56%) Gaps:24/151 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGG 85
            ||.||||.|||.|.|||||:|||||...|.||||  ..|||.|||..|.:|||:..|.|.||.||
plant    46 GLGGGGGIGGGSGLGGGGGFGGGGGLGGGAGGGG--GLGGGAGGGAGGGFGGGAGSGGGLGGGGG 108

  Fly    86 WQKNGGGGGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSWQGGNGGNKNGGGG 150
                .|||..||.|||:.||.||..|.|||..||||                .||.||...|||.
plant   109 ----AGGGFGGGAGGGSGGGFGGGAGAGGGLGGGGG----------------AGGGGGFGGGGGS 153

  Fly   151 GGGGGLYGGGGGGGGKQHGGG 171
            |.|||..||.|.|||  .|||
plant   154 GIGGGFGGGAGAGGG--FGGG 172



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.