DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and Pnlip

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip / 69060 MGIID:97722 Length:465 Species:Mus musculus


Alignment Length:310 Identity:92/310 - (29%)
Similarity:127/310 - (40%) Gaps:71/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YSPDINKMNFQLQTACEKKNFPL-TSPESMWKSPLFDVKKKVVILATG--------WTTTVNGSD 148
            :||......|.|.|.....|:.| ||..|..::..|...:|..|:..|        |.:.:    
Mouse    46 WSPAQINTRFLLYTNENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLSDM---- 106

  Fly   149 TIEVFSKAYNCRG-----DVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLL--DL-VPV 205
                      |:.     .||.:.||......|.||.:..|...:|..:|| ||.:|  || ..:
Mouse   107 ----------CKNMFRVESVNCICVDWKGGSRTTYTQATQNVRVVGAEVAL-LVNVLQSDLGYSL 160

  Fly   206 ENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIHS 270
            .|:||||||||:||.|.||:.    |...|.||||||||:|.|........|...||.|||.||:
Mouse   161 NNVHLIGHSLGSHIAGEAGKR----TFGAIGRITGLDPAEPYFQGTPEEVRLDPTDAQFVDAIHT 221

  Fly   271 NPGVL------GKRDPVGDVDFYPGGMSPLAAGCFS-------------------VTCAHARSWE 310
            :.|.:      |....||.:||:|.|...: .||..                   ..|.|.||::
Mouse   222 DAGPIIPNLGFGMSQTVGHLDFFPNGGIEM-PGCQKNILSQIVDIDGIWEGTRNFAACNHLRSYK 285

  Fly   311 YFAETVFPGNERNFMATRCNSISKLRDFRCPGDEVPMGY-AVPQNIKGNY 359
            ::.:::.  |...|....|:|.|.....:|    .|.|. ..||  .|:|
Mouse   286 FYTDSIV--NPTGFAGFSCSSYSLFTANKC----FPCGSGGCPQ--MGHY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 92/309 (30%)
Pancreat_lipase_like 99..365 CDD:238363 90/304 (30%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 92/310 (30%)
Pancreat_lipase_like 51..348 CDD:238363 90/305 (30%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835424
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.