DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and PNLIPRP2

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_005387.3 Gene:PNLIPRP2 / 5408 HGNCID:9157 Length:469 Species:Homo sapiens


Alignment Length:319 Identity:97/319 - (30%)
Similarity:139/319 - (43%) Gaps:53/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YSPDINKMNFQLQTACEKKNFPL---TSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFS 154
            :||:.....|.|.|.....||.|   |.|::: ::..|.:.:|...:..|:......|...::..
Human    47 WSPEDIDTRFLLYTNENPNNFQLITGTEPDTI-EASNFQLDRKTRFIIHGFLDKAEDSWPSDMCK 110

  Fly   155 KAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDL---VPVENIHLIGHSLG 216
            |.:... .||.:.||.......:||.:..|...:|...|. |::.|..   ..:|::|:||||||
Human   111 KMFEVE-KVNCICVDWRHGSRAMYTQAVQNIRVVGAETAF-LIQALSTQLGYSLEDVHVIGHSLG 173

  Fly   217 AHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIH--SNPGV----L 275
            ||....|||.|    ...:.||||||||.|||.:......|...||.||||||  |:|.|    .
Human   174 AHTAAEAGRRL----GGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGF 234

  Fly   276 GKRDPVGDVDFYPGGMSPLAAGCFS-------------------VTCAHARSWEYFAETVFPGNE 321
            |....||.:||:|.|...: .||..                   |:|.|.||:||::.:|.  |.
Human   235 GMSQKVGHLDFFPNGGKEM-PGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVL--NP 296

  Fly   322 RNFMATRCNSISKLRD---FRCPGDEVP-MGYAVPQNIKG-------NYFLEVSASAPF 369
            ..|:...|.|..:.::   |.||.:..| ||:...| .||       .:||....|..|
Human   297 DGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQ-FKGKTSAVEQTFFLNTGESGNF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 96/316 (30%)
Pancreat_lipase_like 99..365 CDD:238363 93/307 (30%)
PNLIPRP2NP_005387.3 Lipase 18..354 CDD:395099 96/317 (30%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 93..105 2/11 (18%)
Required for galactolipase activity. /evidence=ECO:0000269|PubMed:26494624 257..279 0/21 (0%)
PLAT_PL 357..469 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.