DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and PNLIP

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:336 Identity:96/336 - (28%)
Similarity:134/336 - (39%) Gaps:88/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YSP-DINKMNFQLQTACEKKNF-PLTSPESMWKSPLFDVKKKVVILATG--------WTTTVNGS 147
            :|| |:| ..|.|.|.....|| .:.:..|......|...:|...:..|        |...|   
Human    46 WSPKDVN-TRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANV--- 106

  Fly   148 DTIEVFSKAYNCRG-----DVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDLV---P 204
                       |:.     .||.:.||......|.||.::.|...:|..:|. .|:.|...   .
Human   107 -----------CKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAY-FVEFLQSAFGYS 159

  Fly   205 VENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIH 269
            ..|:|:||||||||..|.|||.    ||.||.||||||||:|||.....|..|...||.||||||
Human   160 PSNVHVIGHSLGAHAAGEAGRR----TNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIH 220

  Fly   270 SN-----PGV-LGKRDPVGDVDFYPGGMSPLAAGCFS-------------------VTCAHARSW 309
            ::     |.: .|....||.:||:|.|...: .||..                   ..|.|.||:
Human   221 TDGAPIVPNLGFGMSQVVGHLDFFPNGGVEM-PGCKKNILSQIVDIDGIWEGTRDFAACNHLRSY 284

  Fly   310 EYFAETV--------FPGNERN-FMATRCNSISKLRDFRCPGDEVP-MGYAVPQ------NIKGN 358
            :|:.:::        ||....| |.|.:|        |.||....| ||:...:      ::...
Human   285 KYYTDSIVNPDGFAGFPCASYNVFTANKC--------FPCPSGGCPQMGHYADRYPGKTNDVGQK 341

  Fly   359 YFLEVSASAPF 369
            ::|:...::.|
Human   342 FYLDTGDASNF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 95/333 (29%)
Pancreat_lipase_like 99..365 CDD:238363 91/323 (28%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 95/334 (28%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145364
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.