DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and PLA1A

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_056984.1 Gene:PLA1A / 51365 HGNCID:17661 Length:456 Species:Homo sapiens


Alignment Length:416 Identity:109/416 - (26%)
Similarity:164/416 - (39%) Gaps:103/416 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NVGTSIVDPSLLPTPQ---------GLLEGSK---QLIAGYPFEFVSNSLNVICSQALASNKIKS 91
            :||:|...|   ||||         .|.||:.   |.:...|       .|..|.|.:..     
Human    20 SVGSSGDAP---PTPQPKCADFQSANLFEGTDLKVQFLLFVP-------SNPSCGQLVEG----- 69

  Fly    92 KYSPDINKMNFQ--LQTACEKKNFPLTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFS 154
              |.|:....|.  |.|......|.:...:..|    .|...:.::.||                
Human    70 --SSDLQNSGFNATLGTKLIIHGFRVLGTKPSW----IDTFIRTLLRAT---------------- 112

  Fly   155 KAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDL-VPVENIHLIGHSLGAH 218
                   :.|.:|||.......:|..:..|..::...|:|.|.|||.| |...:||:||.|||||
Human   113 -------NANVIAVDWIYGSTGVYFSAVKNVIKLSLEISLFLNKLLVLGVSESSIHIIGVSLGAH 170

  Fly   219 IVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGD 283
            :.|..|:    |....:.:|||||||.|.:........|..|||.||:.||::...||.|.|||.
Human   171 VGGMVGQ----LFGGQLGQITGLDPAGPEYTRASVEERLDAGDALFVEAIHTDTDNLGIRIPVGH 231

  Fly   284 VDFY-------PGGMSPLAAGCFSVTCAHARSWEYFAETV--------FP-GNERNFMATRCNSI 332
            ||::       ||..:...||...:.|.|.|:...:...:        || .:.:.|:|.||...
Human   232 VDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLAGRCLDC 296

  Fly   333 SKLRDFRCP--------GDEVPMGYAVPQNIKGNYFLEVSASAPFGMHASVV---------RSAH 380
            .......||        |.::.   .:|:.:|  .:|..::|||:.||.|:|         :..:
Human   297 FNPFLLSCPRIGLVEQGGVKIE---PLPKEVK--VYLLTTSSAPYCMHHSLVEFHLKELRNKDTN 356

  Fly   381 LEHCGLCPESTSTTE--VPSTTTTGK 404
            :|...|....||:::  :|.....||
Human   357 IEVTFLSSNITSSSKITIPKQQRYGK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 81/301 (27%)
Pancreat_lipase_like 99..365 CDD:238363 77/292 (26%)
PLA1ANP_056984.1 Lipase 16..336 CDD:278576 97/368 (26%)
Pancreat_lipase_like 49..332 CDD:238363 84/332 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145188
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.