DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and CG6283

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster


Alignment Length:372 Identity:107/372 - (28%)
Similarity:172/372 - (46%) Gaps:57/372 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLQLLVASIHAIEWSLPDVINSIGNVGTSIVDPSLLPTPQGLLEGSKQLIAGYPFEF--VSNSLN 77
            :|..|:|::.|:  .:.:.:|  |..|..|        |:  |:||        ||:  :.::.:
  Fly     6 VLAALLAAVSAL--PIEERVN--GENGWFI--------PK--LDGS--------FEWMDMQDAED 48

  Fly    78 VICSQALASNKIKSKYSPDINKMNFQLQTACEKKNFPLTSPESMWKS-----PLFDVKKKVVILA 137
            ::.:.|....:|.:      |.:||.:.|    |:.|....|...||     ..|:.......:.
  Fly    49 LLANGAQMEGRIST------NAVNFYVYT----KSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVI 103

  Fly   138 TGWTTTVNGSDTIEV-FSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLD 201
            .|||...  ||.:.. .:||:..:||.|.:.||.||.....|..|.......|..:...:..|.|
  Fly   104 HGWTQRY--SDDMNTRITKAWLSKGDYNVIVVDWARARSVDYASSVLAVPGAGGKVGEMIKYLHD 166

  Fly   202 L--VPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHF 264
            .  :..:::.:||||||||:.|.||:   .:.::.:..|.|||||.|.|:..:....|...|||:
  Fly   167 HHGLDYDSLEVIGHSLGAHVAGYAGK---TVGDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHY 228

  Fly   265 VDVIHSNPGVLGKRDPVGDVDFYP-GGMSPLAAGCFSV-TCAHARSWEYFAETVFPGNERNFMAT 327
            |:.|.:|.|.||...|:|...||| ||.|....|..:. :|:||||..|:||.|   .|.||.:.
  Fly   229 VESIQTNGGKLGFLKPIGKGAFYPNGGKSQPGCGLDATGSCSHARSVLYYAEAV---TEDNFGSI 290

  Fly   328 RCNSISKLRDFRCPG--DEVPMGYAVPQ--NIKGNYFLEVSASAPFG 370
            :|:.........|..  ..|.|| |:..  .::|::::.|::.||||
  Fly   291 KCHDYEDAVAKNCGSTYSSVRMG-AITNAYMVEGDFYVPVNSEAPFG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 88/288 (31%)
Pancreat_lipase_like 99..365 CDD:238363 86/279 (31%)
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 86/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446069
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.