DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and CG6295

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:392 Identity:112/392 - (28%)
Similarity:167/392 - (42%) Gaps:91/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LALLLQLLVASIHAIEWSLPDVINSIGNVGTSIVDPSLLPTPQGLLEGSKQLIAGYPFEFVSNSL 76
            |.|.|...|.:.:|:|      :...|..|..:      |...|.:|...:       ||     
  Fly     4 LFLALAFCVLAANAVE------VRVNGENGWYV------PQADGTMEWMDR-------EF----- 44

  Fly    77 NVICSQALASNKIKSKYSPDINKMNFQLQTACEKKNFPLTSPESMWKSPLFDVKKKVVILATGWT 141
                ::|....|.:.:....:|.:.|.|.|     |....||:.              |.||  :
  Fly    45 ----AEAYLETKNRMEGRNVLNPVTFYLYT-----NSNRNSPQE--------------IKAT--S 84

  Fly   142 TTVNGSD---------TIEVFSKA------YNCR------GDVNFVAVD--AARFVDTLYTWSAF 183
            .:::||.         ||..:|.:      |..|      ||:|.:|||  .||.||  |..|..
  Fly    85 ASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNMIAVDWGRARSVD--YASSVL 147

  Fly   184 NTEEIGENIA--LGLVKLLDLVPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKP 246
            ....:||.:|  :..::....:.::|..:||||||||:.|.||::::   |..:..|.|||||.|
  Fly   148 AVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVK---NGQLHTIIGLDPALP 209

  Fly   247 CFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYP-GGMSPLAAGC---FSVTCAHAR 307
            .|:.......|...||::|:.|.:|.|.||...|:|...||| ||.|  ..||   .:.:|||:|
  Fly   210 LFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKS--QPGCGVDLTGSCAHSR 272

  Fly   308 SWEYFAETVFPGNERNFMATRCNSISKLRDFRCPG--DEVPMGYAV-PQNIKGNYFLEVSASAPF 369
            |..|:||:|   .|.||...||....:.....|..  ..|.||... ...:.|:|::.|.:.||:
  Fly   273 SVIYYAESV---TENNFPTMRCGDYEEAVAKECGSSYSSVRMGATTNAYMVAGDYYVPVRSDAPY 334

  Fly   370 GM 371
            ||
  Fly   335 GM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 94/306 (31%)
Pancreat_lipase_like 99..365 CDD:238363 92/297 (31%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 92/296 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446072
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.