DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and CG4582

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster


Alignment Length:336 Identity:91/336 - (27%)
Similarity:149/336 - (44%) Gaps:56/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QALASNKIKSKYSPDINKMNFQLQTACEKKNFPLTS-PESMW-----KSPLFDVKKKVVILATGW 140
            |.:..|.:.:.:.  :|.||    ...:::|...|| |.:::     :...|.......||..||
  Fly   114 QQVVGNTLTAAFG--LNVMN----KGDQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGW 172

  Fly   141 TTTVNGSDTIEVFSKAYNCR-GDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDL-- 202
            ....|.:...|:....::.| |:.|...||..|.....|..:::..:.:|:.:|    |.:|.  
  Fly   173 LGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLA----KFVDFLH 233

  Fly   203 ----VPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAH 263
                :..|::.|:|.|:|||:.|.||:|||   ...:..|..||||.|.|...:....|...||.
  Fly   234 QEAGMRFEDLQLVGFSMGAHVAGLAGKHLQ---TGRLRMIRALDPALPFFRYAKPKERLTAEDAD 295

  Fly   264 FVDVIHSNPGVLGKRDPVGDVDFYP--GGMSPLAAGCFSVTCAHARSWEYFAETVFPGNERNFMA 326
            :|:|:|::.|..|...|||.||||.  |...|   |||...|:|.|::..|||::.......|::
  Fly   296 YVEVLHTSVGSYGFDRPVGHVDFYANWGSQQP---GCFWHECSHWRAFMLFAESLARDQATGFLS 357

  Fly   327 TRCNSI--SKLRDF-RCPGDEVPMGYAVPQNIKGN---------------YFLEVSASAPF--GM 371
            ..|.:.  .:|..| |||.|.     .|.|.:.|:               |:.:.:...|:  ..
  Fly   358 QGCPAAEWQQLTRFHRCPKDT-----GVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPYVLAQ 417

  Fly   372 HASVVRSAHLE 382
            :||..|:||::
  Fly   418 NASSKRAAHIQ 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 83/307 (27%)
Pancreat_lipase_like 99..365 CDD:238363 82/298 (28%)
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 80/285 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446084
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.