DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and LIPC

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:434 Identity:118/434 - (27%)
Similarity:174/434 - (40%) Gaps:97/434 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TLLALLLQLLVASIHAIEWSLPDVINSIGNVGTSIVDPSLLPTPQGLLEGSKQLIAGYPFEFVSN 74
            |.|.|:..||....|      |.::  |..|.||..|....|            ::..||.    
Human     5 TYLNLIFLLLKPQYH------PQIL--ITGVTTSSEDMRKAP------------VSEEPFG---- 45

  Fly    75 SLNVICSQALASNKIKSKYSPDINKMNFQL----QTACE-KKNFPLTSPESMWKSPLFDVKKKVV 134
                ..:||:.:||...:.     |..|.|    ...|: :.|.|.|..|..:.|.|     .:|
Human    46 ----RRAQAVETNKTLHEM-----KTRFLLFGETNQGCQIRINHPDTLQECGFNSSL-----PLV 96

  Fly   135 ILATGWTTTVNGSDTIEVFSKAYNCRGD----VNFVAVDAARFVDTLYTWSAFNTEEIGENIALG 195
            ::..||  :|:|.....::......:..    ||...||........||.:..||..:|:.:|..
Human    97 MIIHGW--SVDGVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAAL 159

  Fly   196 LVKLLDLVPV--ENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSG-L 257
            |..|.:.|.:  .::||||:|||||:.|.||..:.  ....|.||||||.|.|.| ||.|.|. |
Human   160 LRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSIG--GTHKIGRITGLDAAGPLF-EGSAPSNRL 221

  Fly   258 MRGDAHFVDVIHS----NPGV-LGKRDPVGDVDFYPGGMSPLAAGCF------------------ 299
            ...||:|||.||:    :.|: :|.:.|:|..||||.|.| ...||.                  
Human   222 SPDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGS-FQPGCHFLELYRHIAQHGFNAITQ 285

  Fly   300 SVTCAHARSWEYFAETVFPGNERNFMATRCNSISKLRDFRC----PGDEVPMGYAV---PQNIKG 357
            ::.|:|.||...|.:::.....:: ||..|..::......|    .|....:||.|   |::...
Human   286 TIKCSHERSVHLFIDSLLHAGTQS-MAYPCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSK 349

  Fly   358 NYFLEVSASAPFGMHASVVRSAHLEHCGLCPESTSTTEVPSTTT 401
            ..||...|.:||.::          |.....:..:.||.|..||
Human   350 RLFLVTRAQSPFKVY----------HYQFKIQFINQTETPIQTT 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 91/316 (29%)
Pancreat_lipase_like 99..365 CDD:238363 90/307 (29%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145352
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.