DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and lipg

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:291 Identity:84/291 - (28%)
Similarity:127/291 - (43%) Gaps:71/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FDVKKKVVILATGWTTTVNGSDTIEVFSKAYNCR-GDVNFVAVDAARFVDTLYTWSAFNTEEIGE 190
            |:...:.:::..|||.:......:.....|...| .:.|.|.||.....:.||..:..:|..:|:
Zfish    83 FNATLRTILIIHGWTMSGMFESWMHKLVAAVQRRESEANVVVVDWLGLANQLYPDAVNHTRRVGQ 147

  Fly   191 NIALGLVKLLD------LVPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFN 249
            :||    .|||      .:.:||:|:||:|||||:.|.||.    ..|..|.||||||||.|.|.
Zfish   148 SIA----TLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGT----FVNGIIGRITGLDPAGPMFE 204

  Fly   250 EGEALSGLMRGDAHFVDVIHSNP----GV-LGKRDPVGDVDFYPGG--MSP---------LAAGC 298
            ..::.:.|...||.||||:|:..    || :|.::|:|.:|.||.|  :.|         .|:|.
Zfish   205 GADSYNKLSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCTFGEFLSAASGN 269

  Fly   299 F--SVTCAHARSWEYFAETVF-----------PGNER-------NFMATRCNSI----SKLRDFR 339
            |  ::.|.|.|:...|.:::.           .|.:|       :....|||||    .|:|..|
Zfish   270 FMEAMKCEHERAVHLFVDSLMNKDHVSYAFQCTGPDRFKKGICLSCRKNRCNSIGYNAKKMRKRR 334

  Fly   340 CPGDEVPMGYAVPQNIKGNYFLEVSASAPFG 370
                            ....:|:..|..|||
Zfish   335 ----------------NSKMYLKTRADTPFG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 81/288 (28%)
Pancreat_lipase_like 99..365 CDD:238363 80/284 (28%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 84/291 (29%)
Pancreat_lipase_like 65..344 CDD:238363 80/284 (28%)
PLAT_LPL 351..486 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.