DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and CG14034

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:336 Identity:97/336 - (28%)
Similarity:142/336 - (42%) Gaps:66/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SKQLIAGYPFEFVSNSLNVICSQALASNKIKSKYSPDINKMNFQLQTACEKKNFPLTSPESMWKS 124
            |..|:||.......:..|.||..|..|..:.:|.:.:..|::.          |.|...|.....
  Fly    13 SVMLVAGLDDMNCFSLQNEICPNANISFWLYTKENQEGTKLSV----------FELNRFEFYHHK 67

  Fly   125 PLFDVKKKVVILATGWTTTVNGSDTIEVFSKAYNCR-----GDVNFVAVDAARFV-DTLYTWSAF 183
            ||     ||:|         :|.:....||.....|     .|.|.:::|..:.. :..||.:..
  Fly    68 PL-----KVLI---------HGFNGHRDFSPNTQLRPLFLTQDYNLISLDYPKLAYEPCYTEAVH 118

  Fly   184 NTEEIGENIALGLVKLLD--LVPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKP 246
            |.:.:....|..|..||:  ||.:|::||||..||||:.|..|   |.|....:..||.||||||
  Fly   119 NAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIG---QFLPEHKLEHITALDPAKP 180

  Fly   247 CFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPG-GMSPLAAGCFSVT----CAHA 306
            .:...:....|...||.||||:|::..:||..|.||.||||.. |:|....|..:..    |.|.
  Fly   181 FYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVSQPNCGPINKMETHFCYHN 245

  Fly   307 RSWEYFAETVFPGNERNFMATRCNSISKLRDFRCP-------GDEVP------MGYAVPQNIKGN 358
            |:.:|:||::             :|.|....|.||       |..:|      ||:.|....:|.
  Fly   246 RAADYYAESI-------------SSPSGFYGFYCPNFKSFAKGICIPDKNIELMGFHVDPKARGR 297

  Fly   359 YFLEVSASAPF 369
            |||:.:...|:
  Fly   298 YFLDTNNGPPY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 86/300 (29%)
Pancreat_lipase_like 99..365 CDD:238363 86/291 (30%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 88/305 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.