DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and CG18641

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:255 Identity:79/255 - (30%)
Similarity:113/255 - (44%) Gaps:27/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 KVVILATGWTTTVNGSDTIEVFSKAYNCRGDVNFVAVDAARFVD----TLYTWSAFNTEEIGENI 192
            |::|...|...|::.|..:.   :||...|:.|.:.||.|..|.    :...|:    ...|...
  Fly   106 KIIIHGFGGGRTLSPSPDLR---EAYFSVGEYNIIIVDYADAVKEPCLSQMDWA----PRFGSLC 163

  Fly   193 ALGLVKLLDLVP----VENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEA 253
            ...|||.|...|    .:::|.||:|:||||.|....:|:....: :.|||.|||....:.....
  Fly   164 ISQLVKYLARHPRGVQPDDLHFIGYSVGAHIAGLVANYLKPEEGK-LGRITALDPTIFFYAGANN 227

  Fly   254 LSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPGG--MSPLAAGCF----SVTCAHARSWEYF 312
            ...|...|||||||:|:..|:||:....|..|||..|  ..|...|..    ::.|.|.:...||
  Fly   228 SRDLDSTDAHFVDVLHTGAGILGQWHSSGHADFYVNGGTRQPACVGSATLFQTLACDHTKVTPYF 292

  Fly   313 AETVFPGNERNFMATRC-NSISKLRDFRCPGDE--VPMGYAVPQNIKGNYFLEVSASAPF 369
            .|::  ...|.|.|..| |..|.|..:..|.|.  |.||.......:|||::..:|.|||
  Fly   293 IESI--TTTRGFYAGPCPNLFSYLIGWCEPKDSEYVLMGEHCSHKARGNYYVTTNAKAPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 77/253 (30%)
Pancreat_lipase_like 99..365 CDD:238363 75/249 (30%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.