DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and Yp3

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:414 Identity:118/414 - (28%)
Similarity:171/414 - (41%) Gaps:99/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VASIHAIEWSLPD---------VINSIGNVGTSIVD--PSLLPTPQGLLEGSKQLIAGYPFEFV- 72
            |.|::.|.|...:         ||..|.:||....|  ||.:|:|..:           |...: 
  Fly    42 VPSLNDITWERLENQPLEQGAKVIEKIYHVGQIKHDLTPSFVPSPSNV-----------PVWIIK 95

  Fly    73 SNSLNVICSQALASNKIKSKYSPDINKMNFQLQTACEKKNF------------PLTSP------- 118
            ||...|.|                  |:|..::||..:..|            |.|||       
  Fly    96 SNGQKVEC------------------KLNNYVETAKAQPGFGEDEVTIVLTGLPKTSPAQQKAMR 142

  Fly   119 ----------------------ESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFSKAYNCRG 161
                                  :...||..:|           :|::...:|.   :..|....|
  Fly   143 RLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYD-----------YTSSEEAADQ---WKSAKAASG 193

  Fly   162 DVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDL-VPVENIHLIGHSLGAHIVGSAGR 225
            |:  :.:|....:.....::..:....|..|...|:.|.:. ||.|.|||||..:.||:.|:||.
  Fly   194 DL--IIIDLGSTLTNFKRYAMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAGAAGN 256

  Fly   226 HLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPGG 290
            .....|...:.|||||||||......:.|.||.||||.|||.||::...:|.....|||||||.|
  Fly   257 KYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNG 321

  Fly   291 MSPLAAGCFSVTCAHARSWEYFAETVFPGNERNFMATRCNSISKLRDFRCPGDEVPMGYAVPQNI 355
            .|....|..:|..|.||:..||||:|.||:||||.|...||:.:.::....|....||..:..::
  Fly   322 PSTGVPGSENVIEAVARATRYFAESVRPGSERNFPAVPANSLKQYKEQDGFGKRAYMGLQIDYDL 386

  Fly   356 KGNYFLEVSASAPFGMHASVVRSA 379
            :|:|.|||:|.:|||..:...:.|
  Fly   387 RGDYILEVNAKSPFGQRSPAHKQA 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 95/316 (30%)
Pancreat_lipase_like 99..365 CDD:238363 94/307 (31%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 99/340 (29%)
Abhydrolase <215..396 CDD:304388 76/180 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446010
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.