DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and lpl

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:272 Identity:85/272 - (31%)
Similarity:124/272 - (45%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PESMWKSPLFDVKKKVVILATGWTTT-VNGSDTIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWS 181
            |:|: |...|:.:.|..|:..|||.| :..|...::.:..|......|.:.||........|..|
Zfish    80 PQSI-KDCNFNTETKTFIVIHGWTVTGMFESWVPKLVTALYEREPSANVIVVDWLSRAQQHYPTS 143

  Fly   182 AFNTEEIGENIALGLVKLLDLV------PVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITG 240
            |..|:.:|:::|    |.::.:      |.|.:||:|:|||||:.|.||.    ||...:.||||
Zfish   144 ASYTKLVGKDVA----KFVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAGL----LTKHKVNRITG 200

  Fly   241 LDPAKPCFNEGEALSGLMRGDAHFVDVIHSN-----PGVLGKRDPVGDVDFYPGGMSPLAAGC-- 298
            :|||.|.|...::||.|...||:||||:|:|     ...:|.:.|||.:|.||.| .....||  
Zfish   201 MDPAGPTFEYADSLSTLSPDDANFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNG-GTFQPGCDL 264

  Fly   299 ----------------FSVTCAHARSWEYFAETVFPGNERNFMATRCNSISKL--------RDFR 339
                            ..|.|:|.||...|.:::. ..:...||.||:|....        |..|
Zfish   265 QNTMLMVATTGLRNMDQIVKCSHERSIHLFIDSLV-NQDHESMAFRCSSRDSFNKGMCLSCRKNR 328

  Fly   340 CPGDEVPMGYAV 351
            |.    .:||||
Zfish   329 CN----KVGYAV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 85/272 (31%)
Pancreat_lipase_like 99..365 CDD:238363 85/272 (31%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 85/272 (31%)
Pancreat_lipase_like 56..353 CDD:238363 85/272 (31%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.