DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and LIPH

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:332 Identity:89/332 - (26%)
Similarity:137/332 - (41%) Gaps:88/332 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 NVICSQALASNKIKSKYSPDINKMNFQLQTACEKKNFPLTSPESMWKSPLFDVKKKVVILATGWT 141
            |:.|:|.:.|:.        ...:|...:|......|..|....:|...|               
Human    50 NLTCAQTINSSA--------FGNLNVTKKTTFIVHGFRPTGSPPVWMDDL--------------- 91

  Fly   142 TTVNGSDTIEVFSKAYNCRGDVNFVAVDAARFVDTL-YTWSAFNTEEIGENIALGLVKLLDLV-- 203
              |.|..::|          |:|.|.||..|...|| ||.::..|.:    :|:.|.:.:|.:  
Human    92 --VKGLLSVE----------DMNVVVVDWNRGATTLIYTHASSKTRK----VAMVLKEFIDQMLA 140

  Fly   204 ---PVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFV 265
               .:::|::||.||||||.|..|    .:.:..:.||||||||.|.||.......|...||.||
Human   141 EGASLDDIYMIGVSLGAHISGFVG----EMYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQFV 201

  Fly   266 DVIHSNPGVLGKRDPVGDVDFYP-GGM------SPLAAGCFSVTCAHARS-WEYFAE-------T 315
            |||||:...||.::|:|::|||| ||:      ..:..|.....|.|.|| :.|.:.       |
Human   202 DVIHSDTDALGYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTIT 266

  Fly   316 VFP-GNERNFMATRCNSISKLRDFRCP--------------GDEVPMGYAVPQNIKGNYFLEVSA 365
            .:| .:.:::...:|.|....:...||              |.:.||..|         |.:.:.
Human   267 AYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHLRGKDPPMTKA---------FFDTAE 322

  Fly   366 SAPFGMH 372
            .:||.|:
Human   323 ESPFCMY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 82/310 (26%)
Pancreat_lipase_like 99..365 CDD:238363 82/301 (27%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 81/295 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145337
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.