DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:402 Identity:106/402 - (26%)
Similarity:157/402 - (39%) Gaps:135/402 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PAKMHTLLALLLQLLVASIHAIEWSLPDVINSIGNVGTSIVDPSLLPTPQGLLEGSKQLIAGYPF 69
            |.|::|      :.|:.:||.     |:....|..|.:|.:..|...|.    :.::..|||:  
Human    49 PEKINT------RFLLYTIHN-----PNAYQEISAVNSSTIQASYFGTD----KITRINIAGW-- 96

  Fly    70 EFVSNSLNVICSQALASNKIKSKYSPDINKMNFQLQTACEKKNFPLTSPESMWKSPLFDVKKKVV 134
                              |...|:..|:..:..||:                      |:.    
Human    97 ------------------KTDGKWQRDMCNVLLQLE----------------------DIN---- 117

  Fly   135 ILATGWTTTVNGSDTIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKL 199
            .:...|   :|||   ..:..|.|   ::..|..:.|.|:|.                   |:|.
Human   118 CINLDW---INGS---REYIHAVN---NLRVVGAEVAYFIDV-------------------LMKK 154

  Fly   200 LDLVPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHF 264
            .:..| ..:||||||||||:.|.||..:..|     .||||||||.|.|:.......|...||:|
Human   155 FEYSP-SKVHLIGHSLGAHLAGEAGSRIPGL-----GRITGLDPAGPFFHNTPKEVRLDPSDANF 213

  Fly   265 VDVIHSNP-------GVLGKRDPVGDVDFYPGG----------MSPLAAGCFSV---------TC 303
            |||||:|.       || |..|..|.:||||.|          ::||....|:.         .|
Human   214 VDVIHTNAARILFELGV-GTIDACGHLDFYPNGGKHMPGCEDLITPLLKFNFNAYKKEMASFFDC 277

  Fly   304 AHARSWEYFAETVFPGNERNFMATRCNSISKLRD---FRCPGDEVP-MGYAVP----QNIKGN-- 358
            .||||::::||::.  |...|:|..|.|.:..:.   |.|..:..| ||:...    :|:|.|  
Human   278 NHARSYQFYAESIL--NPDAFIAYPCRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTNGS 340

  Fly   359 -YFLEVSASAPF 369
             |||...:.:||
Human   341 HYFLNTGSLSPF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 87/311 (28%)
Pancreat_lipase_like 99..365 CDD:238363 86/302 (28%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 104/400 (26%)
Pancreat_lipase_like 52..348 CDD:238363 102/393 (26%)
PLAT_PL 355..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145262
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.