DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:319 Identity:99/319 - (31%)
Similarity:144/319 - (45%) Gaps:53/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YSPDINKMNFQLQTACEKKNF---PLTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFS 154
            :||:.....|.|.|.....|:   ..|.|::: |...|.:.:|...:..|:.........:::..
  Rat    60 WSPEDIDTRFLLYTNENPNNYQKISATEPDTI-KFSNFQLDRKTRFIVHGFIDKGEDGWLLDMCK 123

  Fly   155 KAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDL---VPVENIHLIGHSLG 216
            |.:... .||.:.||..|...|.||.:::||..:|..||. ||::|..   ...||:||||||||
  Rat   124 KMFQVE-KVNCICVDWRRGSRTEYTQASYNTRVVGAEIAF-LVQVLSTEMGYSPENVHLIGHSLG 186

  Fly   217 AHIVGSAGRHLQ-HLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIHSNPGVL----- 275
            ||:||.|||.|: |     :.||||||||:|||........|...||.||||||::...:     
  Rat   187 AHVVGEAGRRLEGH-----VGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLG 246

  Fly   276 -GKRDPVGDVDFYPGGMSPLAAGCFS-------------------VTCAHARSWEYFAETVFPGN 320
             |....||.:||:|.|...: .||..                   |.|.|.||::|:|.::.  |
  Rat   247 FGMSQKVGHLDFFPNGGKEM-PGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSIL--N 308

  Fly   321 ERNFMATRCNSISKLRD---FRCPGDEVP-MGYAVPQ------NIKGNYFLEVSASAPF 369
            ...|:...|:|..|.:.   |.||.:..| ||:...|      .::...:|....|..|
  Rat   309 PDGFLGYPCSSYEKFQQNDCFPCPEEGCPKMGHYADQFEGKTATVEQTVYLNTGDSGNF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 98/316 (31%)
Pancreat_lipase_like 99..365 CDD:238363 95/307 (31%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 98/317 (31%)
Pancreat_lipase_like 65..363 CDD:238363 95/308 (31%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.