DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and LOC101884800

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:354 Identity:106/354 - (29%)
Similarity:160/354 - (45%) Gaps:76/354 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LIAGYPFEFVSNSLNVICSQALASN-----KIKSKYSPDINKMNFQLQTACEKKNFPLTSPESMW 122
            |||..|   :.||    ..:|.|||     .|:||:|  |..:.|..:..|    :.:...:...
Zfish    15 LIASEP---IFNS----TEEAFASNFTDYSDIESKFS--IRSVEFPDEDLC----YLVPGQQDSI 66

  Fly   123 KSPLFDVKKKVVILATGWTTTVNG---SDTIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFN 184
            ....|....:..::..||  :|.|   |...::.:..|:.....|.:.||.....:..|..||.|
Zfish    67 SDCNFKNDSQTFLIIHGW--SVAGLFESWVYKLVTALYDREPSANVIVVDWLDRANKHYPKSAEN 129

  Fly   185 TEEIGENIA--LGLVKLLDLVPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPC 247
            |..:|.::|  :..::.|| .|:|.:||:|:|||||:.|.||    :|||..:.||||||||.|.
Zfish   130 TRLVGADVAKFVNWLEELD-YPLEKVHLLGYSLGAHVAGVAG----NLTNNKVHRITGLDPAGPS 189

  Fly   248 FNEGEALSGLMRGDAHFVDVIHSN----PGV-LGKRDPVGDVDFYPGG------------MSPLA 295
            |...:.|..|...||.||||:|:|    |.: :|.:.|||.||.||.|            |..:|
Zfish   190 FENADILRRLSPDDASFVDVLHTNTRGSPDLSIGIQRPVGHVDIYPNGGTFQPGCSIQHTMKLIA 254

  Fly   296 -AGCFS----VTCAHARSWEYFAETVFPGNERNFMATRC---NSISK-----LRDFRCPGDEVPM 347
             .|.::    |.|:|.||...|.:::.....::: |.||   :|.:|     .|..||.    .:
Zfish   255 TCGIYNMDQIVKCSHERSIHLFIDSLVNQAYQSW-AFRCASRDSFNKGLCLSCRKNRCN----TL 314

  Fly   348 GYAVPQNIK-------GNYFLEVSASAPF 369
            ||    |:|       ...:|:.....||
Zfish   315 GY----NVKKIRSTRSTKMYLKTREMMPF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 91/316 (29%)
Pancreat_lipase_like 99..365 CDD:238363 89/307 (29%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 96/327 (29%)
Pancreat_lipase_like 39..335 CDD:238363 94/317 (30%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.