DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5162 and LOC100331214

DIOPT Version :9

Sequence 1:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:331 Identity:101/331 - (30%)
Similarity:147/331 - (44%) Gaps:82/331 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DINKMN--FQLQTACEKKN---FPLTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIE-VFS 154
            |:.|:|  |.|:...:..:   :.:........|..|:...|.:::..|||.:......:| :.:
Zfish    47 DVKKLNVKFSLRNPSQPDDDVCYIVRGKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVA 111

  Fly   155 KAYNCRGDVNFVAVDAARFVDTL---YTWSAFNTEEIGENIALGL--VKLLDLVPVENIHLIGHS 214
            ..||...|.|.:.||   ::||.   |..:|.||:.:|..|.|.:  ::....||:||:||||:|
Zfish   112 ALYNREKDANVIVVD---WLDTAQDHYVVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYS 173

  Fly   215 LGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIHS----NPGV- 274
            ||||:.|.||.|    |...|.||||||||.|.|....|...|...|||||||:|:    :.|: 
Zfish   174 LGAHVAGFAGSH----TTNKIGRITGLDPAGPDFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLS 234

  Fly   275 LGKRDPVGDVDFYP------------GGMSPLAA-GCFSVT----CAHARSWEYFAETVFPGNER 322
            :|...|||.||.||            |.:..:|: |.|::.    |.|.||...|.:::.  ||.
Zfish   235 IGIEQPVGHVDIYPNGGSFQPGCNLRGALEKMASYGIFAINNAIRCEHERSIHLFIDSLL--NEE 297

  Fly   323 ----------NFMATR----------CNS----ISKLRDFRCPGDEVPMGYAVPQNIKGNYFLEV 363
                      |.|..|          ||:    |||:|..|              ::|  .|.:.
Zfish   298 AAGRAYSCGSNDMFDRGVCLQCRKNGCNTVGYDISKVRKAR--------------SVK--MFTKT 346

  Fly   364 SASAPF 369
            ..|.||
Zfish   347 RGSMPF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 99/329 (30%)
Pancreat_lipase_like 99..365 CDD:238363 97/322 (30%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 101/331 (31%)
Pancreat_lipase_like 51..347 CDD:238363 96/320 (30%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578523
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.